PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID GSBRNA2T00143240001
Common NameGSBRNA2T00143240001, LOC106390407
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Brassica
Family CO-like
Protein Properties Length: 318aa    MW: 35451.8 Da    PI: 7.2472
Description CO-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
GSBRNA2T00143240001genomeGenoscopeView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-B_box19.91.5e-061052440
             zf-B_box  4 rkCpeHeekelqlfCedCqqllCedClleeHkg......Htvv 40
                         ++C+++ +   + +C+ ++ +lC +C  + H        H++v
  GSBRNA2T00143240001 10 QVCNTCRSAACTVYCRADSAYLCSTCDAQVHAAnllasrHERV 52
                         58******99*********************657788888776 PP

2zf-B_box32.32.1e-105297342
             zf-B_box  3 erkCpeHeekelqlfCedCqqllCedClleeHkg......Htvvpl 42
                          r+C+ +e+ ++ +fC+ +   lC  C +++H        H++vp+
  GSBRNA2T00143240001 52 VRVCEACERAPAAFFCKADAASLCIACDSQIHLVnplarrHQRVPI 97
                         689*****************************33455556999986 PP

3CCT67.82.9e-23246290145
                  CCT   1 ReaallRYkeKrktRkFeKkirYesRKavAesRpRvKGrFvkqae 45 
                          Rea+++RY+eK+ktRkFeK++rY+sRKa+Ae+RpR+KGrFvk++e
  GSBRNA2T00143240001 246 REARVMRYREKKKTRKFEKRVRYASRKAYAETRPRIKGRFVKREE 290
                          9*****************************************975 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM003366.3E-8754IPR000315B-box-type zinc finger
PROSITE profilePS5011910.694754IPR000315B-box-type zinc finger
CDDcd000215.58E-71154No hitNo description
PROSITE profilePS5011912.1875097IPR000315B-box-type zinc finger
PfamPF006434.3E-85297IPR000315B-box-type zinc finger
CDDcd000218.24E-105397No hitNo description
SMARTSM003362.9E-105597IPR000315B-box-type zinc finger
PROSITE profilePS5101716.847246288IPR010402CCT domain
PfamPF062031.1E-17246288IPR010402CCT domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005622Cellular Componentintracellular
GO:0005515Molecular Functionprotein binding
GO:0008270Molecular Functionzinc ion binding
Sequence ? help Back to Top
Protein Sequence    Length: 318 aa     Download sequence    Send to blast
MLKQDRNWTQ VCNTCRSAAC TVYCRADSAY LCSTCDAQVH AANLLASRHE RVRVCEACER  60
APAAFFCKAD AASLCIACDS QIHLVNPLAR RHQRVPILPI SSMATNHSSE TTAMTGPENI  120
VVMGQEEEDE TEVASWLLPS SEKNSGNNNN SLDLVDYQQD YNVPRSRYAR DGVVPLQVEE  180
SKAHMHHEQH NFQFGFTNVS SGCHMVSLVP ESTTSDTTVV LHSPSPKAAT DQLPDPSTQI  240
LSPGEREARV MRYREKKKTR KFEKRVRYAS RKAYAETRPR IKGRFVKREE VDAEAEADQG  300
FSTMTMFNTG YGVVPSL*
Cis-element ? help Back to Top
SourceLink
PlantRegMapGSBRNA2T00143240001
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAC2400870.0AC240087.1 Brassica oleracea clone BOT01-44D22, complete sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_013686315.10.0PREDICTED: zinc finger protein CONSTANS-LIKE 1-like
SwissprotO500551e-136COL1_ARATH; Zinc finger protein CONSTANS-LIKE 1
TrEMBLA0A078DB680.0A0A078DB68_BRANA; BnaA02g02840D protein
STRINGBra023541.1-P0.0(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM21282670
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G15850.11e-112CONSTANS-like 1
Publications ? help Back to Top
  1. Chalhoub B, et al.
    Plant genetics. Early allopolyploid evolution in the post-Neolithic Brassica napus oilseed genome.
    Science, 2014. 345(6199): p. 950-3
    [PMID:25146293]